Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13628' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13628 13628 13628 13628 13628 13628

Label YdbD (no label) (no label) (no label) (no label) (no label)

X 643 577 569 539 567 568

Y 513 491 510 475 510 509

%V 0.1112 0.0701 0.1420 0.2035 0.4446 0.2284

Ratio - 1.906 3.712

p-value - 0.156 0.155

RSD 22.623 17.784 32.115

mean 0.091 0.173 0.336

median 0.091 0.173 0.336

maximum 0.111 0.203 0.445

minimum 0.070 0.142 0.228

	control	1 min	10 min

ID	13628	13628	13628	13628	13628	13628
Label	YdbD	(no label)	(no label)	(no label)	(no label)	(no label)
X	643	577	569	539	567	568
Y	513	491	510	475	510	509
%V	0.1112	0.0701	0.1420	0.2035	0.4446	0.2284
Ratio	-	1.906	3.712
p-value	-	0.156	0.155
RSD	22.623	17.784	32.115
mean	0.091	0.173	0.336
median	0.091	0.173	0.336
maximum	0.111	0.203	0.445
minimum	0.070	0.142	0.228

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		YdbD	YdbD
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	819	819
	Protein Size (aa)	273	273
	Function	unknown	unknown
Uniprot	Accession	P80878
	Amino Acids	273
	Function
	Gene name	ydbD
	Gene Ontology	F:catalase activity [GO:0004096] F:metal ion binding [GO:0046872]
	Isoelectric Point	4.7873
	Keywords	Calcium Complete proteome Direct protein sequencing Manganese Metal-binding Oxidoreductase Peroxidase Reference proteome Stress response
	Molecular Weight	30257.37
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	YdbD
	Protein name	Probable manganese catalase
	Query text	YdbD
	References	3 references
	Sequence	MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQGWNTRGNEKYKDLLM DTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGGMNPHHAIVSGLGAMPE SSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMTDDKGVKDMLSFLLARDT MHQNQWLAAIKELEAQEGPVVPGTFPKALEKQEFSHQLINFSEGEVSAEQNWLNEKAPDG EAFEYVKEAKTFGEKPELKPAPPFVHNTLPGRE
	Title	MCAT_BACSU
	Uniprot entry	P80878

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13628	13628	13628	13628	13628	13628
Label	YdbD	(no label)	(no label)	(no label)	(no label)	(no label)
X	643	577	569	539	567	568
Y	513	491	510	475	510	509
%V	0.1112	0.0701	0.1420	0.2035	0.4446	0.2284
Ratio	-		1.906		3.712
p-value	-		0.156		0.155
RSD	22.623		17.784		32.115
mean	0.091		0.173		0.336
median	0.091		0.173		0.336
maximum	0.111		0.203		0.445
minimum	0.070		0.142		0.228

Profile

Quantities

Labels

Position on Gel Image 'control_01'