The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13444' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.
| control | 1 min | 10 min | ||||
|---|---|---|---|---|---|---|
| control_01 | control_02 | 1min_01 | 1min_02 | 10min_01 | 10min_02 | |
|
|
|
|
|
|
|
| ID | 13444 | 13444 | 13444 | 13444 | 13444 | 13444 |
| Label | Dps | (no label) | (no label) | (no label) | (no label) | (no label) |
| X | 779 | 724 | 705 | 665 | 706 | 702 |
| Y | 802 | 767 | 796 | 754 | 795 | 793 |
| %V | 0.8041 | 0.2831 | 1.0654 | 1.3740 | 0.9587 | 0.8229 |
| Ratio | - | 2.244 | 1.639 | |||
| p-value | - | 0.155 | 0.326 | |||
| RSD | 47.924 | 12.652 | 7.627 | |||
| mean | 0.544 | 1.220 | 0.891 | |||
| median | 0.544 | 1.220 | 0.891 | |||
| maximum | 0.804 | 1.374 | 0.959 | |||
| minimum | 0.283 | 1.065 | 0.823 | |||
| Scout | Attribute | control | Fused Images |
|---|---|---|---|
| control_01 | Fused Image | ||
| Label name(s) | Dps | Dps | |
| Pi/MW Estimation | Pi | N.A. | N.A. |
| MW | N.A. | N.A. | |
| GenoList | Gene Size (bp) |
435
|
435
|
| Protein Size (aa) |
145
|
145
|
|
| Function |
|
|
|
| Uniprot | Accession |
P80879
|
|
| Amino Acids |
145
|
|
|
| Function |
|
|
|
| Gene name |
dps
|
|
|
| Gene Ontology |
|
|
|
| Isoelectric Point |
4.368
|
|
|
| Keywords |
|
||
| Molecular Weight |
16593.73
|
|
|
| NCBI Taxonomy |
224308
|
|
|
| Organism |
Bacillus subtilis (strain 168)
|
|
|
| Original label name |
Dps
|
|
|
| Protein name |
General stress protein 20U
|
|
|
| Query text |
Dps
|
|
|
| References |
|
||
| Sequence |
MSEQLIQAVNKQVANWTVMYVKLHNYHWYVKGKDFFTLHEKFEELYNETATYIDDLAERL
LALNGKPIATMKESLETASVKEAAGNETAEQMVQSVYDDFTVIAEELKNGMDLADEVGDE
TTGDMLLAIHQNIEKHNWMLKAYLG
|
|
|
| Title |
G20U_BACSU
|
|
|
| Uniprot entry |
|