Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13438' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13438 13438 13438 13438 13438 13438

Label Dps (no label) (no label) (no label) (no label) (no label)

X 816 753 738 692 745 733

Y 783 748 777 737 777 775

%V 0.1499 0.0644 0.0806 0.0875 0.0402 0.0681

Ratio - 0.784 0.505

p-value - 0.644 0.360

RSD 39.910 4.075 25.693

mean 0.107 0.084 0.054

median 0.107 0.084 0.054

maximum 0.150 0.087 0.068

minimum 0.064 0.081 0.040

	control	1 min	10 min

ID	13438	13438	13438	13438	13438	13438
Label	Dps	(no label)	(no label)	(no label)	(no label)	(no label)
X	816	753	738	692	745	733
Y	783	748	777	737	777	775
%V	0.1499	0.0644	0.0806	0.0875	0.0402	0.0681
Ratio	-	0.784	0.505
p-value	-	0.644	0.360
RSD	39.910	4.075	25.693
mean	0.107	0.084	0.054
median	0.107	0.084	0.054
maximum	0.150	0.087	0.068
minimum	0.064	0.081	0.040

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		Dps	Dps
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	435	435
	Protein Size (aa)	145	145
	Function
Uniprot	Accession	P80879
	Amino Acids	145
	Function
	Gene name	dps
	Gene Ontology	C:cell [GO:0005623] F:ferric iron binding [GO:0008199] F:oxidoreductase activity, oxidizing metal ions [GO:0016722] P:cellular iron ion homeostasis [GO:0006879] P:response to stress [GO:0006950]
	Isoelectric Point	4.368
	Keywords	Complete proteome Direct protein sequencing Reference proteome Stress response
	Molecular Weight	16593.73
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	Dps
	Protein name	General stress protein 20U
	Query text	Dps
	References	3 references
	Sequence	MSEQLIQAVNKQVANWTVMYVKLHNYHWYVKGKDFFTLHEKFEELYNETATYIDDLAERL LALNGKPIATMKESLETASVKEAAGNETAEQMVQSVYDDFTVIAEELKNGMDLADEVGDE TTGDMLLAIHQNIEKHNWMLKAYLG
	Title	G20U_BACSU
	Uniprot entry	P80879

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13438	13438	13438	13438	13438	13438
Label	Dps	(no label)	(no label)	(no label)	(no label)	(no label)
X	816	753	738	692	745	733
Y	783	748	777	737	777	775
%V	0.1499	0.0644	0.0806	0.0875	0.0402	0.0681
Ratio	-		0.784		0.505
p-value	-		0.644		0.360
RSD	39.910		4.075		25.693
mean	0.107		0.084		0.054
median	0.107		0.084		0.054
maximum	0.150		0.087		0.068
minimum	0.064		0.081		0.040

Profile

Quantities

Labels

Position on Gel Image 'control_01'